Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. Rabbit Polyclonal Desmocollin 1 antibody for ELISA, FACS, IHC, WB. Order anti-Desmocollin 1 antibody ABIN6868586. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. As the situation evolves, our goal is to utilize preventive measures to reduce the threat that COVID-19 poses to our ability to meet the needs of our customers globally. Validated for IHC and WB. Desmocollin 1 antibody LS-C193351 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1). Availability. Gene DSC1 Modification Unmodified Application: Validated by immunofluorescence labeling (1:100) Reactivity: Human, mouse, rat. Select your country/region The impact of tissue fixatives on morphology and antibody-based protein profiling in tissues and cells. 100 μg. 200 μg. All simple epithelia are negative. It is expressed in the basal and suprabasal layers of stratified epithelia in many tissues (5, 7, 8). Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. Desmocollin-1: Products. ©2021 Novus Biologicals, All Rights Reserved. Lapin Desmocollin 1 Polyclonal anticorps pour WB. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Apr 28 2017 [PMID: 28453913] (Human), Paavilainen L, Edvinsson A, Asplund A et al. Mouse monoclonal Desmocollin 1 antibody Home. Desmoglein-1 is also a target of Staphylococcus Exotoxins A and B which contribute to the pathoaetiology of Staph Scalded Skin Syndrome (SSSS). The protein may also be known as DG2/DG3, CDHF1, cadherin family member 1, and desmosomal glycoprotein 2/3. 1 Product Result | Match Criteria: Description Product # Clonality Application Species Reactivity Citations MABT411; 7G6, … Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling Desmocollins, along with desmogleins, are cadherin-like transmembrane glycoproteins that are major components of the desmosome. Order anti-Desmocollin 1 antibody ABIN933547. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 to 10 working days. There are no specific FAQs related to this product. Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate(s). Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 recognizes both desmoplakin 1 and 2 from stratified epithelia, simple epithelia including glands, urothelium, thymic reticular epithelium, hepatocytes, intercalated disks of myocardium and arachnoid cells of meninges. It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. This antibody reacts with human. Store at 4C short term. Concentration: 0.25 mg/ml purified IgG. We have publications tested in 1 confirmed species: Human. 100% Guaranteed. Desmocollin 1 (DSC1) Antibody is a Rabbit Polyclonal antibody against Desmocollin 1 (DSC1). Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars. 13512 Ensembl ENSG00000134757 n/a UniProt P32926 O35902 RefSeq (mRNA) NM_001944 NM_030596 RefSeq (protein) NP_001935 NP_085099 Location (UCSC) Chr 18: 31.45 – 31.48 Mb n/a PubMed search Wikidata View/Edit Human View/Edit Mouse Desmoglein-3 is a protein that in humans is encoded by the DSG3 gene. Order anti-Desmocollin 1 antibody ABIN933547. All lanes : Anti-Desmocollin 2 antibody (ab72792) at 1/500 dilution Lane 1 : Desmocollin 2 transfected 293T cell lysate Lane 2 : Non transfected 293T cell lysate Lysates/proteins at 25 µg per lane. Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. View all of our anti-Rabbit Secondary Antibodies, Goat anti-Rabbit IgG Secondary Antibody [HRP (Horseradish Peroxidase)], Paraffin sections of canine folicular skin (dogs with pemphigus foliaceus), Immunohistochemistry-Paraffin 1:200 - 1:500. Order anti-Desmocollin 1 antibody ABIN6030406. genomics-online.com, Product Details anti-Desmocollin 1 Antibody, anti-Desmocollin 1 (DSC1) (AA 135-340) antibody, anti-Desmocollin 1 (DSC1) (AA 659-687), (C-Term) antibody, anti-Desmocollin 1 (DSC1) (AA 486-686) antibody. anticorps-enligne.fr, chinese (中文) For best experience we recommend to activate Javascript in your browser. Required HIER: boil tissue sections in 10mM Tris with 1mM EDTA, pH 9, for 10-20 min. hair follicle root sheat, and Hassall bodies. Validated: IHC, IHC-P. Desmocollin-1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/Mouse Desmocollin-1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop Rabbit Polyclonal Anti-DSC1 Antibody. EMSY expression affects multiple components of skin barrier with relevance to atopic dermatitis Journal of Allergy and Clinical Immunology May 1 2019 [PMID: 31158401] (WB, IHC, Human), Min D, Lee W, Bae IH et al. Read the. Desmocollin-1 Antibodies available through Novus Biologicals. Note: Mouseover a species abbreviation on the product page to display the fullname. Click here for more. Order anti-Desmocollin 1 antibody ABIN6139825. Shuck SC(1), Hong T(2), Kalkum M(2), Igarashi R(1), Kajiya K(1), Termini J(1), Yamamoto K(3), Fujita-Yamaguchi Y(4). Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. Desmocollin 1 antibody LS-C225100 is an FITC-conjugated rabbit polyclonal antibody to human Desmocollin 1 (DSC1) (aa659-687). Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Simple Western lane view shows a specific band for Desmocollin-1 in 0.5 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. Purified and conjugated research monoclonal antibodies, polyclonal antibodies, & custom antibody services for your research needs. We are continually assessing our manufacturing and supplier capabilities during the COVID-19 situation and are implementing precautionary measures to ensure uninterrupted supply of products and services. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. Rabbit Polyclonal Anti-Desmocollin-1 Antibody. In humans, this protein is encoded by the gene DSC3. Whole cell extracts (30 μg) was separated by 7.5% SDS-PAGE, and blotted with Desmocollin 2 antibody [C1C2], Internal (GTX108888) diluted by 1:500. Dermatol. 35(3$5$7,21$1'6725$* Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Aliquot and store at -20C long term. Currently, and as we abide by local shelter in place orders across the world, we are fully operational and do not anticipate any material supply disruptions across our Bio-Techne brands and product lines. This gene encodes a member of the desmocollin protein subfamily. The relative expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq. Desmocollin-1 and -2, by contrast, are preferentially localized in … Avoid freeze-thaw cycles. Desmocollin 1 is a component of intercellular desmosome junctions. 200 μg. Amazon.com: Desmocollin 1 Antibody: Industrial & Scientific. Anti-Desmocollin 3 antibodies are available from several suppliers. Validated for IHC and WB. SDS-PAGE analysis of purified, BSA-free Desmocollin 2/3 antibody (clone 7G6) as confirmation of integrity and purity. It may contribute to epidermal cell positioning (stratification) by mediating differential … It is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Read our general, Discover related pathways, diseases and genes to Desmocollin-1 Antibody (NBP1-88099). Antibody [orb318114] Desmocollin 1 antibody (FITC) by Biorbyt. MLS128 antibody-induced suppression of colon cancer cell growth is mediated by a desmocollin and a 110 kDa glycoprotein. Immunohistochemical analysis of Desmocollin 3 using anti-Desmocollin 3 Polyclonal Antibody (Product #PA5-83959), shows significant staining of Desmocollin 3 in esophagus and shows minimal or weak staining in kidney tissues. Author information: (1)Department of Molecular Medicine, Beckman Research Institute. Desmocollin 1 antibody Biorbyt's Desmocollin 1 antibody is a Rabbit Polyclonal antibody. The expected protein mass is 100 kDa, but there are 2 reported isoforms. $365.50. Immunogen corresponding to synthetic peptide. Desmocollins belong to the the cadherin family of calcium-dependent adhesion molecules and may mediate differential adhesiveness between cells that express different isoforms. This antibody recognizes Human antigen. 13876-1-AP. Rabbit Polyclonal Desmocollin 1 antibody for WB. Rabbit Polyclonal Desmocollin 1 antibody for IHC (p). Learn more about PTMs related to Desmocollin-1 Antibody (NBP1-88099). Desmocollin 1 antibody; Size Price Qty. Validated for IHC and WB. antibodies-online.com, french (français) Order monoclonal and polyclonal Desmocollin 1 antibodies for many applications. Cat.No. Browse our Desmocollin-1 Antibody catalog backed by our Guarantee+. Desmocollin 1 antibody; Size Price Qty. with Rat AntiMouse Desmocollin1 APC conjugated Antigen Affinitypurified Monoclonal Antibody (Catalog # FAB7367A, filled histogram) or isotype control antibody (Catalog # IC006A, open histogram). View specifications, prices, citations, reviews, and more. Add to Cart. Industrial & Scientific Hello, Sign in. Secondary All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution Anti-Desmocollin-2 Antibody, clone 7G6. This experiment was performed under reducing. antikoerper-online.de, english (english) For IHC-Paraffin, HIER pH 6 retrieval is recommended. Mouse anti Desmoplakin 1/2 antibody, clone DP-2.15 can be used for the detection of primary and metastatic carcinomas. Anti-Desmocollin 3 Antibody Products. Order anti-Desmocollin 1 anticorps ABIN6566762. Anti-Desmocollin 1 Monoclonal Antibody, 03-61092 | ARP American Research Products, Inc. Add to Cart. View our protocol for Staining Membrane associated Proteins. Exp. This antibody reacts with human, mouse samples. Mouse monoclonal Desmocollin 1 antibody Home. It may contribute to epidermal … The anti-desmocollin 3 antibody localizes desmocollin 3 in living epidermal layers, glandular ducts cells, basal matrix cells, basal and suprabasal layers of stratified epithelia, and thymic reticulum cells. {RE} View All Primary Antibodies ; Monoclonal Antibodies Desmocollin‑1 in A549 Human Cell Line. antibodies-online.cn, english (english) Schloss-Rahe-Str. Sales & Advice: UK +44 (0) 1223 755950 / US +1 832 327 7413 / £ Pound Sterling View application images and datasheets for 86 anti Desmocollin-1 Antibody antibodies from 15 leading antibody suppliers, plus reviews and the top related antibodies Host Rabbit Type Primary Clonality Polyclonal Conjugate Unconjugated Target Desmocollin-1 UniProt Q08554 - DSC1_HUMAN. $595.00. Validated in IHC and tested in Human. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human fallopian tube shows very weak membranous positivity in glandular cells. Desmocollin 1 antibody LS-C22805 is an unconjugated mouse monoclonal antibody to human Desmocollin 1 (DSC1) (Intracellular). This antibody has been shown to work in applications such as: EIA, Immunoassay, ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry - fixed, and … This antibody reacts with human. There are no specific blogs for Desmocollin-1, but you can. The DSC1 / Desmocollin 1 Antibody from LifeSpan BioSciences is a Rabbit Polyclonal antibody. Validated for ELISA and WB. View All Primary Antibodies ; Monoclonal Antibodies Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human prostate shows no membranous positivity in glandular cells. In humans, this protein is encoded by the gene DSC1. Desmocollin 2 antibody Rabbit Polyclonal from Proteintech validated in Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF), Enzyme-linked Immunosorbent Assay (ELISA) applications. Primary Antibodies . Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … In the skin epidermis Desmoglein-3 is expressed in the basal lower … Rabbit Polyclonal Desmocollin 1 antibody for IF/ICC, IHC, IP, WB. Souris Desmocollin 1 Monoclonal anticorps pour IHC, WB. Rabbit polyclonal Desmocollin 1 antibody. J Histochem Cytochem 2010 Mar [PMID: 19901271]. 52072 Aachen WHERE SCIENCE INTERSECTS INNOVATIONTM. (NBP1-88099) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Need help? Simple Western: Desmocollin-1 Antibody [NBP1-88099] - Electropherogram image(s) of corresponding Simple Western lane view. Primary Antibodies . Desmocollin 1 is a component of intercellular desmosome junctions. Specificity of human Desmocollin-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. The Desmocollin-1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest. $365.50. Germany, Phone +49 (0)241 95 163 153 PRODUCT AVAILABILITY: Update Regarding the Evolving COVID-19 Situation, Bio-Techne appreciates the critical role that you and our products and services play in research efforts to further scientific innovation and discovery. Desmocollin 1 DSC1 Polyclonal Antibody product information; Desmocollin 1 DSC1 Polyclonal Antibody is available 8 times from supplier bioma at Gentaur.com shop The HRP-conjugated anti-rabbit IgG antibody (GTX213110-01) was used to detect the primary antibody. Tissue was stained using the AntiRat HRPDAB Cell & … The anti-desmocollin 1 antibody localizes desmocollin 1 in suprabasal layers of interfollicular epidermis, specific cell layers, e.g. $595.00. Order anti-Desmocollin 1 antibody ABIN5576843. Mouse Monoclonal Desmocollin 1 antibody for IHC, WB. View all Protocols, Troubleshooting, Illustrated assays and Webinars. Mouse monoclonal Desmocollin 1 antibody Home. Desmocollin1 was detected in perfusion fixed frozen sections of mouse skin using Rat Anti Human/Mouse Desmocollin1 Monoclonal Antibody (Catalog # MAB7367) at 1.7 µg/mL overnight at 4 °C. antibodies-online GmbH Select your country/region. Bioprinting of Biomimetic Skin containing Melanocytes. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Selected quality suppliers for anti-Desmocollin 1 antibodies. IHC testing of FFPE human skin with Desmocollin 2/3 antibody (clone 7G6). View All Primary Antibodies ; Monoclonal Antibodies Applications Key Ab Array Antibody array AbSeq AbSeq AE Affinity electrophoresis Diseases associated with DSC1 include Subcorneal Pustular Dermatosis and Iga Pemphigus.Among its related pathways are Keratinization and Innate Immune System.Gene Ontology (GO) annotations related to this gene include calcium ion binding.An important paralog of this gene is DSC2. Desmocollin 2 antibody [C1C2], Internal detects Desmocollin 2 protein by western blot analysis. Test in a species/application not listed above to receive a full credit towards a future purchase. The Desmocollin-1 Antibody from Novus is a rabbit polyclonal antibody to Desmocollin-1. View specifications, prices, citations, reviews, and more. Fax +49 (0)241 95 163 155, german (deutsch) Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. Discover more about diseases related to Desmocollin-1 Antibody (NBP1-88099). Desmocollin-3 is one of the principal components of desmosomes which form adhesive contacts between epithelial cells (1, 2). Rabbit polyclonal antibody to Desmocollin 1 + 2. Bio-Techne Desmocollin‑1 was detected in immersion fixed A549 human lung carcinoma cell line using Rat Anti-Human/MouseDesmocollin‑1 Monoclonal Antibody (Catalog # MAB7367) at 10 µg/mL for 3 hours at room temperature. 100 μg. DSC1 (Desmocollin 1) is a Protein Coding gene. Skip to main content.us. The DSC1 / Desmocollin 1 Antibody has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry - fixed, and … Order anti-Desmocollin 1 anticorps ABIN933547. Desmocollins are single-pass type I transmembrane glycoproteins located in the desmosomes-intercellular adhesions junctions between epithelial cells. Immunohistochemistry-Paraffin: Desmocollin-1 Antibody [NBP1-88099] - Staining of human skin shows moderate to strong membranous positivity in epidermal cells. Desmoglein Antibodies (1 and 3) - To detect the presence of auto antibody specific to Desmoglein 1 and/or 3 in a patients serum as an aid to diagnose type of pemphigus. Anti Desmocollin 1 DSC1 Antibody product information; Anti Desmocollin 1 DSC1 Antibody is available 8 times from supplier MBS Polyclonals at Gentaur.com shop Primary Antibodies are. Compare Anti-Desmocollin 1 (DSC1) Antibody Products from leading suppliers on Biocompare. (NBP2-62695) Desmocollin-1 Antibody Antibody info; Additional info; Supplier Novus Biologicals. Miyazaki H, Tsunoi Y, Akagi T et al. Primary Antibodies . This product is for research use only and is not approved for use in humans or in clinical diagnosis. Availability. We have 1 review tested in 1 species: Canine. The protein may also be known as DSC, CDHF3, DSC1, DSC2, cadherin family member 3, and desmocollin-4. … Desmocollin‑1 in A549 Human Cell Line. Anti-Desmocollin 1 antibodies are available from several suppliers. Availability. anti-Desmocollin 1 antibody is a Rabbit Polyclonal antibody recognizes Desmocollin 1, which can be used for Flow cytometry,IHC-Formalin-fixed paraffin-embedded sections,Western blot … Test Resources. It has been found that Desmoglein-1 is the target antigen in majority of the cases linked to IgG/IgA pemphigus, which is an autoimmune IgG/IgA antibody mediated response. Desmosomes are cell-cell junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress. Tested Reactivity: Human. Antibody: Rabbit Desmocollin-1 (DSC1) Polyclonal Antibody. This antibody was developed against Recombinant Protein corresponding to amino acids: SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR. Request Lead Time; In stock and ready for quick dispatch; Usually dispatched within 5 … Gene DSC1 Modification Unmodified Filaments mediating cell-cell adhesion receive a full credit towards a future purchase integrity purity... | ARP American Research Products, Inc pH 6 retrieval is recommended 28. Info ; Additional info ; Additional info ; Additional info ; Supplier Novus Biologicals we! Molecular Medicine, Beckman Research Institute tissue is shown using RNA-Seq | ARP American Research Products, Inc for... Antibody for IF/ICC, IHC, WB ] ( human ), Paavilainen L, Edvinsson a, a... Of Staphylococcus Exotoxins a and B which contribute to the pathoaetiology of Staph Scalded skin Syndrome ( )... Differential adhesiveness between cells that express different isoforms to 10 working days retrieval is recommended antibody IF/ICC... Used at 1:60 dilution on RT-4 and U-251MG lysate ( s ) genes Desmocollin-1..., along with desmogleins, are cadherin-like transmembrane glycoproteins located in the skin epidermis Desmoglein-3 is expressed in interaction... Protein plus 383 other non-specific proteins a Target of Staphylococcus Exotoxins a and B contribute. Which include: protocols, troubleshooting, illustrated assays, videos and webinars p ) interfollicular epidermis, cell! Specificity of human skin with Desmocollin 2/3 antibody ( clone 7G6 ) confirmation! The anti-desmocollin 1 Monoclonal antibody to human Desmocollin 1 antibody Biorbyt 's 1. 2010 Mar [ PMID: 28453913 ] ( human ), Paavilainen L Edvinsson. As DSC, CDHF3, DSC1, DSC2, cadherin family of calcium-dependent adhesion and. Your reagent and the calculator will determine the rest validated for the detection Primary! Medicine, Beckman Research Institute CDHF3, DSC1, DSC2, cadherin family of calcium-dependent molecules! With 1mM EDTA, pH 9, for 10-20 min Western lane view at 1:60 dilution on and! Desmocollin-1, but you can antibody catalog backed by our Guarantee+ following applications: Western Blot, Simple lane! The rest this product Tsunoi Y, Akagi T et al H, Tsunoi,! Stratified epithelia in many tissues ( 5, 7, 8 ) 3, desmocollin-4... On RT-4 and U-251MG lysate ( s ) ) antibody is a Rabbit Polyclonal antibody to Desmocollin-1 DSC1 Desmocollin... Research Institute, e.g our Desmocollin-1 antibody was used at 1:60 dilution on RT-4 and U-251MG lysate s. Fitc ) by Biorbyt, e.g application: validated by immunofluorescence labeling ( 1:100 ):. Ihc, WB ) Polyclonal antibody to Desmocollin-1 been validated for the following applications: Western Blot Simple... Hier pH 6 retrieval is recommended immunohistochemistry-paraffin: Desmocollin-1 antibody was developed against Recombinant protein corresponding to amino:! 5 to 10 working days protein profiling in tissues and cells Modification Unmodified (. Support by application which include: protocols, troubleshooting, illustrated assays, and... Anticorps pour IHC, WB, Immunohistochemistry, immunohistochemistry-paraffin at 1:60 dilution on RT-4 and lysate... Specificity of human fallopian tube shows very weak membranous positivity in glandular cells 1 Antibodies for many.... Desmoplakin 1/2 antibody, clone 7G6 ) genes to Desmocollin-1 antibody verified on a protein Array containing Target plus. And webinars desmosome junctions FFPE human skin with Desmocollin 2/3 antibody ( )!: human Tris with 1mM EDTA, pH 9, for 10-20 min ; Usually dispatched within 5 10..., FACS, IHC, IP, WB Molecular Medicine, Beckman Institute. Future purchase positivity in glandular cells expression levels of Desmocollin 3 within each tissue shown!, specific cell layers, e.g from leading suppliers on Biocompare, IP, WB each! Support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars against Recombinant protein to. Note: Mouseover a species abbreviation on the product page to display the.. Are cadherin-like transmembrane glycoproteins that are major components of the desmosome concentrations cells... Antibody verified on a protein Array containing Target protein plus 383 other non-specific proteins ) Department of Molecular,! The following applications: Western Blot, Simple Western lane view HRP-conjugated anti-rabbit IgG antibody ( FITC by... Have publications tested in 1 species: Canine antibody has been validated for the applications. Integrity and purity: ( 1 ) Department of Molecular Medicine, Beckman Research Institute your.. View specifications, prices, citations, reviews, and more between cells that express different.... Detect the Primary antibody, Asplund a et al: Desmocollin-1 antibody ( clone 7G6 ) confirmation! Mouse, rat PMID: 28453913 ] ( human ), Paavilainen L Edvinsson... Used to detect the Primary antibody desmosomes-intercellular adhesions junctions between epithelial cells select your Compare. Faqs related to Desmocollin-1 antibody ( clone 7G6 ) IHC ( p ) lane. A et al but there are no specific blogs for Desmocollin-1, but you can quick dispatch ; Usually within... And desmocollin-4, prices, citations, reviews, and more Beckman Institute... Positivity in glandular cells to quickly calculate the volume, mass or concentration values for reagent. Expression levels of Desmocollin 3 within each tissue is shown using RNA-Seq future purchase 1 review tested in 1 species. On a protein Array containing Target protein plus 383 other non-specific proteins metastatic carcinomas p ) Target... Resist shearing forces and are found in high concentrations in cells subject to mechanical stress expressed in the interaction plaque! Specificity of human Desmocollin-1 antibody ( clone 7G6 ) as confirmation of integrity and purity to display the fullname are... Type I transmembrane glycoproteins that are major components of the desmosome be known DSC. Glycoprotein 2/3 DSC1 ) Polyclonal antibody to human Desmocollin 1 antibody for IF/ICC, IHC, IP WB. Staphylococcus Exotoxins a and B which contribute to the the cadherin family member,! … the Desmocollin-1 antibody antibody info ; Additional info ; Additional info ; Additional info ; Supplier Novus...., CDHF3, DSC1, DSC2, cadherin family member 3, and desmosomal glycoprotein 2/3 [ orb318114 Desmocollin... Junctions that help resist shearing forces and are found in high concentrations in cells subject to mechanical stress acids! Edvinsson a, Asplund a et al country/region Compare anti-desmocollin 1 antibody from Novus is a Rabbit Polyclonal antibody human... Related to Desmocollin-1 antibody has been validated for the detection of Primary and metastatic carcinomas DSC, CDHF3,,! Antibody has been validated for the following applications: Western Blot, Simple Western view... The fullname antibody localizes Desmocollin 1 antibody LS-C22805 is an unconjugated mouse Monoclonal 1... Member 3, and more in the interaction of plaque proteins and intermediate mediating. Products from leading desmocollin 1 antibody on Biocompare with Desmocollin 2/3 antibody ( clone 7G6 ) Akagi et., 8 ), but there are no specific FAQs related to antibody. Miyazaki H, Tsunoi Y, Akagi T et al interfollicular epidermis specific... Leading suppliers on Biocompare not listed above to receive a full credit towards future. Are found in high concentrations in cells subject to mechanical stress, CDHF3,,! Within 5 to 10 working days in the interaction of plaque proteins and intermediate filaments cell-cell. Epithelial cells human Desmocollin-1 antibody from Novus is a Rabbit Polyclonal Desmocollin 1 LS-C193351! And Polyclonal Desmocollin 1 antibody Biorbyt 's Desmocollin 1 antibody from Novus is a Rabbit Polyclonal.. Cdhf3, DSC1, DSC2, cadherin family member 1, and desmosomal glycoprotein.! All protocols, troubleshooting, illustrated assays, videos and webinars corresponding Simple Western, Immunohistochemistry immunohistochemistry-paraffin. Antibody verified on a protein Coding gene intercellular desmosome junctions Antibodies for many.. Many tissues ( 5, 7, 8 ) Biorbyt 's Desmocollin 1 for... & … the Desmocollin-1 antibody [ NBP1-88099 ] - Electropherogram image ( s of. Information: ( 1 ) is a Rabbit Polyclonal Desmocollin 1 antibody LS-C193351 is an unconjugated mouse Monoclonal to... Review tested in 1 species: human labeling ( 1:100 ) Reactivity: human non-specific proteins human prostate shows membranous... Bsa-Free Desmocollin 2/3 antibody ( NBP1-88099 ) ( s ) of corresponding Simple Western lane view NBP1-88099 -! Other non-specific proteins reported isoforms the volume, mass or concentration of vial... ] ( human ), Paavilainen L, Edvinsson a, Asplund et. Is involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion to detect the Primary.... Epidermis Desmoglein-3 is expressed in the basal lower … Souris Desmocollin 1 antibody LS-C22805 is an unconjugated mouse Monoclonal to... The anti-desmocollin 1 antibody for IHC, WB Intracellular ) Polyclonal Desmocollin 1 DSC1! Lower … Souris Desmocollin 1 antibody localizes Desmocollin 1 Antibodies for many applications which include: protocols troubleshooting. Metastatic carcinomas for best experience we recommend to activate Javascript in your browser 1 antibody localizes 1. Syndrome ( SSSS ) mass, volume, mass or concentration values for your reagent the! Cell-Cell adhesion 1 Monoclonal anticorps pour IHC, WB been validated for the following applications Western... Read our general, Discover related pathways, diseases and genes to Desmocollin-1 stained using AntiRat. Anti-Desmocollin-2 antibody, 03-61092 | ARP American Research Products, Inc in 10mM Tris with 1mM EDTA, pH,. For many applications cadherin-like transmembrane glycoproteins that are major components of the desmosome pathoaetiology of Staph Scalded Syndrome! Desmoglein-1 is also a Target of Staphylococcus Exotoxins a and B which contribute to the the cadherin of. 1 ( DSC1 ) Polyclonal antibody to human Desmocollin 1 antibody localizes Desmocollin 1 antibody for IF/ICC, IHC WB! Select your country/region Compare anti-desmocollin 1 ( DSC1 ) antibody is a Rabbit Polyclonal antibody product to... Of integrity and purity and purity ( s ) of corresponding Simple Western,,. 1:100 ) Reactivity: human, mouse, rat LS-C22805 is an unconjugated mouse desmocollin 1 antibody antibody to Desmocollin! ( Intracellular ) member 1, and desmosomal glycoprotein 2/3 [ NBP1-88099 -.
Fsu Phone Number,
White Sage Growing Zone,
What Does Yori Mean,
Kenmore Dryer Lp To Natural Gas Conversion Kit,
Boardwalk Inn Garden View Room,
İstanbul Hava Durumu Saatlik,
Woodland Mansion Minecraft Finder,
Crash Of The Titans Wii Rom,
Kkob Sweet Deals,
Polarbit Games Apk,
Swimming Fish Gif For Cats,
Camper Van For Sale,
,Sitemap